8U9OB

Solution structure of rsgi9 cre domain from c. thermocellum
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
155
structure length
155
Chain Sequence
PSVEFTINSKHKVIVTSAINQDASEVLDGLELKEKDLKSALVMVLEKAESLGYISDDKNYVLVSMALNDKNKKTRDKREEKIDELKETIEQGIEALDNDTIVHRTVTVDLEERNKALENELSMGRYYLYLEAKEKGMDITIDEVKSSKISDLIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Anti-sigma-I factor RsgI9
publication title Insight into the autoproteolysis mechanism of the RsgI9 anti-sigma factor from Clostridium thermocellum.
pubmed doi rcsb
source organism Acetivibrio thermocellus dsm 1313
total genus 41
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2023-09-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...