8UAIC

Crystal structure of hetero hexameric hazelnut allergen cor a 9
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
470
structure length
414
Chain Sequence
RHFGECNLDRLNVVEPTNRITSEGGTVEKWDTNQQQFQCAGVAAIRRTIEPNSEVQPNYQPAPMLIYIEKGRGLLGVVIPGCAETYESQSHQQNKGQRASQGQSQRQDQHQRVHRIREGDILAIPAGVVHWIYNDGDQQLVAFAVVNQNNKANQLDEEYRPFLLAGGQPDEQGQKGQKQQQQAESQNIFSGFDVELLAEAYNIPVDIVRRQQQQDKRGNLVKLEQQQIKIIRAEQETICSLRLRENMTTRSQSDIVSRQAGRINIVNQQKLPVLRYLNMSAERGHLFPDALYVPHWAQNNHRVIYVIRGNAQVQISDDNGNNVFDREIRQGNVFTIPQFFAAISRAGSEGFEYVSIKTAGNPNKSTLAGRTSVIRAIPADVLANSFQISPEEAQRLKHNRGKQTLVLSSSRISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of hetero hexameric 11S seed storage protein of hazelnut.
pubmed doi rcsb
molecule keywords 11S globulin 1
molecule tags Allergen
total genus 104
structure length 414
sequence length 470
chains with identical sequence F
ec nomenclature
pdb deposition date 2023-09-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...