8UCA3T

Formation of i2+iii2 supercomplex rescues respiratory chain defects
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
78
structure length
56
Chain Sequence
MLSVAARSGPFAPVLSATSRGVAGRPFLCRESLSGQAAARPLVATVGLNVPASVRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Formation of I 2 +III 2 supercomplex rescues respiratory chain defects.
pubmed doi rcsb
molecule keywords NADH-ubiquinone oxidoreductase chain 3
molecule tags Electron transport, translocase
source organism Mus musculus
total genus 3
structure length 56
sequence length 78
ec nomenclature ec 7.1.1.8: quinol--cytochrome-c reductase.
pdb deposition date 2023-09-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...