8UCKa

Komagataella pastoris cytochrome c oxidase (9 subunits) in complex with human vmat2
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
535
structure length
535
Chain Sequence
MNYINRWLFSTNAKDIAVLYFIFALFCGLLGSIMSLILRLELSAPGNQILMGNHQLFNVVATAHAVLMVFFLVMPAAIGFFGNYLLPLMIGASDMSFARLNNISFWLLPPALVSLLASALIENGAGTGWTVYPPLAGVQSHSGPSVDLAIFALHLTSISSLLGAINFITTTLNMRTIGMTMSKLPLFVWAVVFTSILLLLSLPVLSAGVTLLLLDRNFNTSFFEPAGGGDPILYQHLFWFFGHPEVYILIIPGFGIISHIVSTYSKKPVFGAIGMVYAMGSIGFLGLLVWSHHMYTVGLDVDSRAYFTSATMVIAVPTGIKIFSWLATLYGGSIRYTTPMLYAFAFLFLFTVGGLSGVVLSNASLDIAFHDTYYVIGHFHYVLSLGAVFSLFAGYYYWSPLITGLYYNNNLANIQFWLLFIGTNVTFFPMHFLGLNGMPRRIPDYPDAFAGWNAISSFGSLISIISVILFAYVIYDQLVNGLTNKQLSTNSLFKNPDFIESNIIFNDNSIKSSSIDFLLTSPPLPHTFNTPAIQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Komagataella pastoris Cytochrome c oxidase (9 subunits) in complex with human VMAT2
rcsb
molecule keywords Synaptic vesicular amine transporter
molecule tags Membrane protein
source organism Homo sapiens
total genus 133
structure length 535
sequence length 535
ec nomenclature ec 7.1.1.9: cytochrome-c oxidase.
pdb deposition date 2023-09-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...