8UD61X

Crystal structure of the wild-type thermus thermophilus 70s ribosome in complex with cresomycin, mrna, deacylated a-site trnaphe, aminoacylated p-site fmet-trnamet, and deacylated e-site trnaphe at 2.70a resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
95
structure length
95
Chain Sequence
MKTAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVKVVKVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome/rna
molecule keywords 23S Ribosomal RNA
publication title An antibiotic preorganized for ribosomal binding overcomes antimicrobial resistance
rcsb
source organism Escherichia coli
total genus 21
structure length 95
sequence length 95
chains with identical sequence 2X
ec nomenclature ec ?:
pdb deposition date 2023-09-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...