8UD813

Crystal structure of the a2503-c2,c8-dimethylated thermus thermophilus 70s ribosome in complex with cresomycin, mrna, deacylated a-site trnaphe, aminoacylated p-site fmet-trnamet, and deacylated e-site trnaphe at 2.70a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
59
structure length
59
Chain Sequence
PRLKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVAHLVRVEVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An antibiotic preorganized for ribosomal binding overcomes antimicrobial resistance
rcsb
molecule tags Ribosome/rna
source organism Escherichia coli
molecule keywords 23S Ribosomal RNA
total genus 18
structure length 59
sequence length 59
chains with identical sequence 23
ec nomenclature ec ?:
pdb deposition date 2023-09-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...