8UDBA

Crystal structure of mu class gst from tugstm12 (tetur05g05300) from tetranychus urticae
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
223
structure length
223
Chain Sequence
APILGYWKLRGLGEPIRLLLAHTGQEYEMKEYSFGPEPDYDKSEWLDEKFNLGLDFPNLPYYIDEEEGVKMTQTVAIIRYLARKHGLVGESDEETIKIEMVEQQAIELIFTCTRTWYCRDDDLFDKLKEEMMTILPGKLIGLAKFLGENQYIIGDRITYVDFMLYSILDYIRLFEESLFDEASSLKDYLTRIESLPEIEKYLSSDDFKRFPITGPMAKFGGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of mu class Glutathione-S-Transferease (GST) from Tetranychus urticae
rcsb
molecule keywords Glutathione-S-Transferase
molecule tags Transferase/substrate
source organism Tetranychus urticae
total genus 77
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 2.5.1.18: glutathione transferase.
pdb deposition date 2023-09-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...