8UFGF

Acinetobacter baylyi lptb2fg bound to acinetobacter baylyi lipopolysaccharide
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
349
structure length
316
Chain Sequence
IIRRYLVKQVVSTSLVVIALLTLIMMGGRLIKYFGVAAQGRLDAGVLFSIIGYRMPEFLTLILPLGFFIGLMLVFGRLYVDHEMAVLNGSGISRIRLGQLLIPLALVFLVIQGILMLWMTPWGLRQFDQLSSSQAVRTGFDLVRPKEFISSGPYTIYAGDLSEDRKNLKDIFFYQDVMILAKEATRNVVDLIQGRRYEIYSQAEFQRYRLRLKVEALPSSKLWNKWNDPVIASEMGWRVFGPFTIVIALMMAVALCEVSPRQGRYYRLIPAIFIFASLIVLLIAIRTRISRDELGVWAYPAALAVYGIAAALFSRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A new antibiotic traps lipopolysaccharide in its intermembrane transporter
doi rcsb
molecule keywords Lipopolysaccharide export system ATP-binding protein LptB
molecule tags Lipid transport
source organism Acinetobacter baylyi adp1
total genus 108
structure length 316
sequence length 349
ec nomenclature
pdb deposition date 2023-10-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...