8UGSC

Cryo-em structure of bovine phosphodiesterase 6 bound to cgmp
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
75
structure length
34
Chain Sequence
SATRVMGGPVTPRKGPPKFKQRQTRQFELAQYGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Probing the mechanism by which the retinal G protein transducin activates its biological effector PDE6.
pubmed doi rcsb
molecule keywords Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha
molecule tags Signaling protein/inhibitor
total genus 2
structure length 34
sequence length 75
chains with identical sequence D
ec nomenclature
pdb deposition date 2023-10-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...