8UGWA

Computational design of highly signaling active membrane receptors through de novo solvent-mediated allosteric networks
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
419
structure length
385
Chain Sequence
NQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNLMDIFEMLRIDEGGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSAAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSTIFSMLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMMGVYLRIFLAARERARSTLQKEVHAAKSLAIYLGLFLLCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Computational design of highly signalling-active membrane receptors through solvent-mediated allosteric networks.
pubmed doi rcsb
molecule keywords Endolysin,Adenosine receptor A2a
molecule tags Membrane protein
source organism Tequatrovirus t4
total genus 148
structure length 385
sequence length 419
ec nomenclature ec 3.2.1.17: lysozyme.
pdb deposition date 2023-10-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...