8UH41

Cryo-em structure of maize streak virus (msv) - single head geminivirus
Total Genus 27

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
213
structure length
213
Chain Sequence
AGSKADRPSLQIQTLQHAGTTMITVPSGGVCDLINTYARGSDEGNRHTSETLTYKIAIDYHFVADAAACRYSNTGTGVMWLVYDTTPGGQAPTPQTIFAYPDTLKAWPATWKVSRELCHRFVVKRRWLFNMETDGRIGSDIPPSNASWKPCKRNIYFHKFTSGLGVRTQWKNVTDGGVGAIQRGALYMVIAPGNGLTFTAHGQTRLYFKSVGN

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS7 (151-163)TIV1 (32-35)S8 (184-191)TIV6 (173-176)S1 (41-47)TII'1 (48-51)3H3 (208-210)TVIII1 (49-52)S2 (54-55)S3 (60-63)S9 (196-200)TI1 (63-66)TII2 (72-75)AH1 (124-127)S4 (80-83)S6 (103-114)TI2 (98-101)TIV2 (99-102)TIV3 (114-117)3H2 (132-134)TIV4 (134-137)TI3 (137-140)TI5 (145-148)TIV5 (144-147)S5 (86-94)TI8 (167-170)TII1 (56-59)TIV7 (180-183)S10 (211-213)3H1 (96-98)Updating...
connected with : NaN
molecule tags Virus/dna
source organism Maize streak virus genotype a (isolate nigeria)
publication title The Two States of MSV Gemini Capsid Assembly
rcsb
molecule keywords Capsid protein
total genus 27
structure length 213
sequence length 213
chains with identical sequence 2, 3, 4, 5, 6, 7, 8, A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z, a, b, c, d, e, f, g, h, i, j, k, l, m, n, o, p, q, r, s, t, u, v, w, x, y, z
ec nomenclature
pdb deposition date 2023-10-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.