8UHFA

Cryo-em of vibrio cholerae toxin co-regulated pilus - asymmetric reconstruction
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
199
structure length
192
Chain Sequence
MTLLEVIIVLGIMGVVSAGVVTLAQRAIDSQNMTKAAQSLNSIQVALTQTYRGADATAASKLTSGLVSLGKISSDEAKNPFIGTNMNIFSFPRNAAANKAFAISVDGLTQAQCKTLITSVGDMFPYIAIKAGGAVALADLGDFENSAAAAETGVGVIKSIAPASKNLDLTNITAVEKLCKGTAPFGVAFGNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Toxin co-regulated pilin
publication title Tad and toxin-coregulated pilus structures reveal unexpected diversity in bacterial type IV pili.
pubmed doi rcsb
total genus 45
structure length 192
sequence length 199
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2023-10-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...