8UINC

Structure of the c3bbb-albicin complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
116
structure length
116
Chain Sequence
ANNHIRTVLKLFRTIDLDDSKKSFYLTAAKYGIQTQLREPIIRIVGGYLPSTKLSEACVKNMISEVYEIEGDFYSKFSYACEDHAPYSVECLEDARDDYLTQLVELFKETKKCLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of complement inhibition by a mosquito protein revealed through cryo-EM
rcsb
molecule tags Immune system
source organism Anopheles albimanus
molecule keywords Albicin
total genus 37
structure length 116
sequence length 116
chains with identical sequence D
ec nomenclature
pdb deposition date 2023-10-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...