8UM2A

Carboxy terminus of oleate hydratase in phosphate buffer
Total Genus 13

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
42
structure length
42
Chain Sequence
NDHQDLREITKDSKMQKLALAGFLKKIKGTYIESLLKEHKLL

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lipid transport
publication title The carboxy terminus causes interfacial assembly of oleate hydratase on a membrane bilayer.
pubmed doi rcsb
molecule keywords Myosin-cross-reactive antigen
total genus 13
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2023-10-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.