8UMSA

Site-specific aspartic acid dehydration and isomerization in streptococcal protein gb1: l-isoasp40 variant
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
55
Chain Sequence
MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Probing effects of site-specific aspartic acid isomerization on structure and stability of GB1 through chemical protein synthesis.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Immunoglobulin G-binding protein G
total genus 15
structure length 55
sequence length 56
ec nomenclature
pdb deposition date 2023-10-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...