8UT5G

Cryoem structure of a/michigan/45/2015 h1 in complex with flu ha central stem vh1-18 antibody uca6_n55t
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
125
structure length
125
Chain Sequence
VQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYTGNTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARGLLQGVVILDSYYYTMDVWGQGTTVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Eliciting a single amino acid change by vaccination generates antibody protection against group 1 and group 2 influenza A viruses.
pubmed doi rcsb
molecule tags Viral protein/immune system
source organism Influenza a virus
molecule keywords Hemagglutinin HA1 chain
total genus 21
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2023-10-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...