8UU4W

Cryo-em structure of the listeria innocua 70s ribosome in complex with hpf (structure i-a)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
99
structure length
99
Chain Sequence
MHVKKGDKVKVITGKDKGKSGKVLAAFPKKDRVLIEGINMVKKHTKPSNINPQGGILNVEAPIHVSNVMLIDPKTGEPTRVGYEVKGDKKVRVAKKSGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanistic insights into the alternative ribosome recycling by HflXr
rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 8
structure length 99
sequence length 99
ec nomenclature ec ?:
pdb deposition date 2023-10-31
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...