8UX1K

Cryo-em structure of ran bound to rcc1 and the nucleosome core particle
Total Genus 35

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
171
structure length
162
Chain Sequence
PQVQFKLVLVGDGGTGKTTFVKRHLTGKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFV

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTI2 (54-57)S1 (9-17)S3 (59-65)TIV4 (112-115)TII1 (18-21)AH1 (23-29)TI1 (40-43)TIV1 (41-44)TI5 (91-94)AH3 (100-112)TI'1 (66-69)TI3 (68-71)TI4 (70-73)AH2 (77-82)S4 (85-91)3H1 (95-98)S5 (117-122)TIV5 (121-124)TI6 (132-135)TIV6 (141-144)AH4 (135-140)S6 (145-150)TIV8 (151-154)TIV7 (150-153)TIV9 (154-157)AH5 (158-169)S2 (48-52)Updating...
connected with : NaN
publication title Cryo-EM structure of Ran bound to RCC1 and the nucleosome core particle
rcsb
molecule keywords Histone H3
molecule tags Nuclear protein
source organism Drosophila melanogaster
total genus 35
structure length 162
sequence length 171
ec nomenclature
pdb deposition date 2023-11-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.