8UZDA

The structure of ipcs3, a theobromine methyltransferase from yerba mate
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
342
structure length
333
Chain Sequence
CFSQKVTSITKPILVNAIHSLFSEYFHREKVLNVADLGCAAGPNPFSVILTVKESLERKCKELNCQPAELQVYLNDLPGNDFNSLFKDLSGLRTCFVMGAPGSFYGRLFPRSCLHLVHSCYSVHWLSQVPKGLTSKEGLPLNKGKINISKTSPPVVEAAYLAQFKEDFTLLLKSRAEEMVQNGRMVLILNGRQASDPWGKESCYHWEVLAEAISEMVSQGLVDEEKLDSFNVPCYAPSQEEVQDIVDKVGSFAVEHIETFTLPFANDQESDTRVKGEQLAKNIRSFTESIISYEFGKEITEKVYHKLTQIVVKDMASRPPTNTTVVVVLSRTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Plant protein
molecule keywords IpCS3
publication title Yerba mate (Ilex paraguariensis) genome provides new insights into convergent evolution of caffeine biosynthesis
rcsb
source organism Ilex paraguariensis
total genus 121
structure length 333
sequence length 342
chains with identical sequence B
ec nomenclature
pdb deposition date 2023-11-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...