8V3LA1

Microtubule inner proteins in the 48-nm doublet microtubule from the proximal region of tetrahymena thermophila strain k40r
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
168
structure length
141
Chain Sequence
TPQQILNQIIKPEYIKYYSDWIHTANEKEARGLQLLGAIYKHKGSKKFFDFQKAEEMYRKSQITSSYGQEFGNVFKYKKCSDLPFAKPLSDLAKLFIDNWIELNDELEFQELVLACLRSLHSRCIAQEVPKTEMKTKYEWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title 48-nm doublet microtubule from the proximal region of Tetrahymena thermophila strain K40R
rcsb
molecule keywords CCDC81B
molecule tags Structural protein
total genus 36
structure length 141
sequence length 168
ec nomenclature
pdb deposition date 2023-11-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...