8V5OA

Tetramer core subcomplex (conformation 3) of xenopus laevis dna polymerase alpha-primase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
182
structure length
182
Chain Sequence
RDCERFKFFCPKCGTENIYDNVFDGSGLQIEPGLKRCSKPECDASPLDYVIQVHNKLLLDIRRYIKKYYSGWLVCEEKTCQNRTRRLPLSFSRNGPICQACSKATLRSEYPEKALYTQLCFYRFIFDWDYALEKVVSEQERGHLKKKLFQESENQYKKLKSTVDQVLSRSGYSEVNLSKLFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A mechanistic model of primer synthesis from catalytic structures of DNA polymerase alpha-primase
rcsb
molecule tags Replication, transferase
source organism Xenopus laevis
molecule keywords DNA polymerase alpha catalytic subunit
total genus 47
structure length 182
sequence length 182
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2023-11-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...