8V5YA

Crystal structure of tyr p 36.0101 in complex with a poly(l-proline) peptide
Total Genus 41

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
133
structure length
133
Chain Sequence
GSGSWQSYVDNQICQHVDCRLAVIAGLQDGAVWAKFEKDLPKQITQQELKTIADAIRSNPNSFLEGGIHLGGEKYICIQADNSLVRGRKGSSALCIVATNTCLLAAATVDGFPPGQLNNVVEKLGDYLKANNY

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Allergen
source organism Tyrophagus putrescentiae
publication title Structural homology of mite profilins to plant profilins is not indicative of allergic cross-reactivity.
pubmed doi rcsb
molecule keywords Profilin
total genus 41
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2023-12-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.