8V7OL

Fab fragment of human mab #58 in complex with computationally optimized broadly reactive h1 influenza hemagglutinin x6
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
109
structure length
109
Chain Sequence
EIVLTQSPATLSLSPGERATLSCRASQSVATSLAWYQQKPGQPPRLLIYDASHRATAIPARFTGSGSGTDFTLTISSLEPEDFAVYYCQQRTHWPPALTFGGGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the broad antigenicity of the computationally optimized influenza hemagglutinin X6
rcsb
molecule keywords Hemagglutinin
molecule tags Viral protein/immune system
source organism Influenza a virus
total genus 12
structure length 109
sequence length 109
chains with identical sequence M, N
ec nomenclature
pdb deposition date 2023-12-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...