8VFVA

Hiv env bg505_md39_b16 sosip boosting trimer in complex with b16_d77.5 mouse fab and rm20a3 fab
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
471
structure length
436
Chain Sequence
NLWVTVYYGVPVWKDAETTLFCASDHNVWATHACVPTDPNPQEIHLENVTEEFNMWKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLQCTNYTEKLRSMMKGELKNCSFNMTTELRDKKQKVYSLFYRLDVVQINKEYRLINCNTSAITQACPKVSFEPIPIHYCAPAGFAILKCKDKKFNGTGPCPSVSTVQCTHGIKPVVSTQLLLNGSLAEEEVIIRSENITNNAKNILVQLNTPVQINCTRPNNNTVKSIRIGPGQAFYYTGDIIGHIRQAHCNVSKATWNETLGKVVKQLRKHFGNNTIIRFAQSSGGDLEVTTHSFNCGGEFFYCNTSGLFNSTWISNDSITLPCRIKQIINMWQRIGQAMYAPPIQGVIRCVSNITGLILTRDGSTTETFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTRCKRRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title mRNA-LNP HIV-1 trimer boosters elicit precursors to broad neutralizing antibodies
doi rcsb
molecule keywords RM20A3 Fab heavy chain
molecule tags Viral protein/immune system
source organism Macaca mulatta
total genus 96
structure length 436
sequence length 471
chains with identical sequence E, J
ec nomenclature
pdb deposition date 2023-12-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...