8VKQBA

Cw flagellar switch complex - flif, flig, flim, and flin forming the c-ring from salmonella
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
287
structure length
287
Chain Sequence
XXXXXXXLQALEIINERFARQFRMGLFNLLRRSPDITVGAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVVFSPSLVFIAVDNLFGGDGRFPTKVEGREFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSEMQVKFTNITTSPNDIVVNTPFHVEIGNLTGEFNICLPFSMIEPLRELLVNPPLENSRHEDQNWRDNLVRQVQHSELELVANFADIPLRLSQILKLKPGDVLPIEKPDRIIAHVDGVPVLTSQYGTVNGQYALRVEHLINPILNSLNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Motor protein
molecule keywords Flagellar M-ring protein
publication title Structural basis for rotation and directional switching by the combined MS- and C-rings of bacterial flagella.
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 44
structure length 287
sequence length 287
chains with identical sequence BD, BG, C, DC, DF, FB, FE, HA, HD, HG, JC, JF, K, LB, LE, M, NA, ND, NG, PC, PF, RB, RE, TA, TD, TG, V, VC, VF, XB, XE, ZA, ZD
ec nomenclature ec ?:
pdb deposition date 2024-01-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...