8VL8A

Salmonella enterica typhimurium taxis to serine and repellents (tsr) ligand-binding domain with l-ser, ph 7
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
140
structure length
140
Chain Sequence
VLQTIRQQQSALNATWVELLQTRNTLNRAGIRWMMDQSNIGSGATVAELMQGATNTLKLTEKNWEQYEALPRDPRQSEAAFLEIKRTYDIYHGALAELIQLLGAGKINEFFDQPTQSYQDAFEKQYMAYMQQNDRLYDIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Human Serum is a Potent Chemoattractant for Enterobacteriaceae Species Associated with Gastrointestinal Bleeding
doi rcsb
molecule tags Signaling protein
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule keywords Methyl-accepting chemotaxis protein
total genus 65
structure length 140
sequence length 140
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2024-01-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...