8VSYA

Bile salt hydrolase from arthrobacter citreus with covalent inhibitor aaa-10 bound
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
318
structure length
318
Chain Sequence
CTGIRYSDGSGNLYLARNLDWTSDFGERVVVTPTGYTTKSPFGAVPAIRHAVIGMGIVQEDTPLYFDCGNDAGLAVAGLNFPGYAQYATEAVDGATNVAAFEFPLWVASQFASVDEVEAALADVVIVDRPINDKYPSSLLHWIIGDSKRAIVVEYTSDGLHVFDDDVDVLANQPGFGWHHENLRNYLNASPDFPEKIVLNRADLVPFGSGSLMRGIPGDYYSPSRFVRAAYVHAHYPGKSTEEENVSRAFHTLQQVAMVDGSAAMGSGEFEKTTYTGLFSSRTMTYYWNTYEDPAVRSVAMADHAADGTELVVVLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Bile salt hydrolase from Arthrobacter citreus with covalent inhibitor AAA-10 bound
rcsb
molecule keywords Bile salt hydrolase
molecule tags Hydrolase/hydrolase inhibitor
source organism Arthrobacter citreus
total genus 89
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature
pdb deposition date 2024-01-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...