8VYEH

Sars-cov-2 s (c.37 lambda variant) plus s309, s2l20, and s2x303 fabs
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
125
structure length
125
Chain Sequence
QITLKESGPTLVKPTQTLTLTCKLSGFSVNTGGVGVGWIRQPPGKALEWLALIYWNDDKLYSPSLKSRLTVTKDTSKNQVVLTMTNMDPVDTATYYCAHVLVWFGEVLPDAFDVWGQGTMVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Quantifying how single dose Ad26.COV2.S vaccine efficacy depends on Spike sequence features.
pubmed doi rcsb
molecule keywords Spike glycoprotein
molecule tags Viral protein/immune system
source organism Severe acute respiratory syndrome coronavirus 2
total genus 15
structure length 125
sequence length 125
chains with identical sequence M, T
ec nomenclature
pdb deposition date 2024-02-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...