8VZNC

Cryo-em structure of flvcr2 in the inward-facing state with choline bound
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
83
structure length
62
Chain Sequence
ITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPSDFATYYCQQSYGSLVTFGQGTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and molecular basis of choline uptake into the brain by FLVCR2
doi rcsb
molecule tags Transport protein
source organism Mus musculus
molecule keywords Feline leukemia virus subgroup C cellular receptor 2
total genus 6
structure length 62
sequence length 83
ec nomenclature
pdb deposition date 2024-02-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...