8W22A

Umb1 umbrella toxin particle (local refinement of umbb1 bound alf of umbc1 and umba1)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
DNRIDAARMAMTGGSGLRQAAKDAIRLSPAELEKFLLYGYEEPLDDDHKVEIARLINLGGPGVREAGKAALQGTAEERELFLNSGQYTAQQDDNRVDVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Streptomyces umbrella toxin particles block hyphal growth of competing species
doi rcsb
molecule keywords Intein C-terminal splicing domain-containing protein
molecule tags Toxin
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2024-02-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...