8W22B

Umb1 umbrella toxin particle (local refinement of umbb1 bound alf of umbc1 and umba1)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
125
structure length
125
Chain Sequence
EMPQAVEDFSYPGAAKIQAETGAILKRGNGHMLMTSCDGSEDIQVMSRTGQKDFCFNVMAKPAYLTLEVPQAYGIWTSADPVKTTIKDTDGTATVINAPANDFTGYGEAGSTGEPTTLIELRVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Toxin
molecule keywords Intein C-terminal splicing domain-containing protein
publication title Streptomyces umbrella toxin particles block hyphal growth of competing species
doi rcsb
total genus 18
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2024-02-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...