8W5JE

Cryo-em structure of the yeast tom core complex (from tom-tim23 complex)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
42
structure length
42
Chain Sequence
KILTLTHNVAHYGWIPFVLYLGWAHTSNRPNFLNLLSPLPSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The architecture of substrate-engaged TOM-TIM23 supercomplex reveals preprotein proximity sites for mitochondrial protein translocation.
pubmed doi rcsb
molecule keywords Mitochondrial import receptor subunit TOM40
molecule tags Translocase
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 10
structure length 42
sequence length 42
chains with identical sequence M
ec nomenclature ec ?:
pdb deposition date 2023-08-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...