8WA1A

The cryo-em structure of the nicotiana tabacum pep-pap-tec2
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
318
structure length
288
Chain Sequence
TRTLQWKCVESRTDSKRLYYGRFILSPLMKGQADTIGIAMRRALLGEIEGTCITRVKSEKVPHEYSTITGIQESVHEILMNLKEIILRSNLYGTSDASICVKGPGSVTAQDIILPPYVEIVDNTQHIASLTEPIDFCIGLQIERNRGYLIKTPHNFQDGSYPIDAVFMPVRNANHSIHSYGNGNEKQEILFLEIWTNGSLTPKEALHEASRNLIDLFIPFLHMEEDNIALKSIFIDQSELPSRIYNCLKMSNIYTLLDLLNNSQEDLMKIEHFRSEDVKRILGILEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cryo-EM structures of the plant plastid-encoded RNA polymerase.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 55
structure length 288
sequence length 318
chains with identical sequence a
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2023-09-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...