8WI9q

Cryo- em structure of mycobacterium smegmatis 30s ribosomal subunit (body 2) of 70s ribosome, bs1 and rafh.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
113
structure length
113
Chain Sequence
AVKIKLTRLGKIRNPQYRIIVADARTRRDGRAIEVIGRYHPKEEPSLIQIDSERAQYWLGVGAQPTEPVLALLKITGDWQKFKGLPGAEGTLKVKEPKPSKLDLFNAALAEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
pubmed doi rcsb
molecule tags Ribosome
source organism Mycolicibacterium smegmatis mc2 155
molecule keywords 16S rRNA
total genus 25
structure length 113
sequence length 113
ec nomenclature ec ?:
pdb deposition date 2023-09-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...