8WTZA

Potassium outward rectifier channel skor
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
454
structure length
447
Chain Sequence
HPDNRWYKAWTMFILIWALYSSFFTPLEFGFFRGLPENLFILDIAGQIAFLVDIVLTFFVAYRDSRTYRMIYKRSSIALRYLKSTFIIDLLACMPWDIIYKAAGEKEEVRYLLLIRLYRVHRVILFFHKMEKDIRINYLFTRIVKLIFVELYCTHTAACIFYYLATTLPASQEGYTWIGSLKLGDYSYSKFREIDLWTRYTTSMYFAVVTMATVGYGDIHAVNMREMIFAMVYISFDMILGAYLIGNMTALIVKGSKTERFRDKMADIMRYMNRNKLGRNIRGQITGHLRLQYESSYTEAAVLQDIPVSIRAKIAQTLYLPYIEKVPLFRGCSSEFINQIVIRLHEEFFLPGEVIMEQGSVVDQLYFVCHGVLEEIGEIVAVLQPDHSFGEISILCNIPQPYTVRVAELCRILRLDKQSFMNILEIFFHDGRRILNNLLEGKESNVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural changes in the conversion of an Arabidopsis outward-rectifying K + channel into an inward-rectifying channel.
pubmed doi rcsb
molecule keywords Potassium channel SKOR
molecule tags Metal transport
source organism Arabidopsis thaliana
total genus 144
structure length 447
sequence length 454
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2023-10-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...