8WYCE

Cryo-em structure of dsr2 (h171a)-tube-nad+ (partial) complex
Total Genus 15

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
229
structure length
116
Chain Sequence
TADVYFKRKSDGKLVFTAEAQTASFSQAISEEKLRKPLYILKSEKEINLTVKNAFFDLEWLAMTQRYEVEYRIYIQFPNVSPSGEFEMSLENGLAPEIKFEALADTDTDEMAVVIE

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Antiviral protein
source organism Bacillus subtilis
publication title Structural basis for phage-mediated activation and repression of bacterial DSR2 anti-phage defense system.
pubmed doi rcsb
molecule keywords SIR2-like domain-containing protein
total genus 15
structure length 116
sequence length 229
chains with identical sequence G
ec nomenclature
pdb deposition date 2023-10-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.