8X3VA

Crystal structure of 2c from encephalomyocarditis virus bound with atp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
217
structure length
208
Chain Sequence
RCEPVVIVLRGDAGQGKSLSSQVIAQAVSKTIFGRQSVYSLPPDSDFFDGYENQFAAIMDDLGQNPDGSDFTTFCQMVSTTNFLPNMGTPFTSQLVVATTNLPEFRPAHYPAVERRITFDYSVSAGPVCSKTEAGYKVLDVERAFRPTGEAPLPCFQNNCLFLEKAGLQFRDNRTKEIISLVDVIERAVARIERKKKVLTTVQTLVAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of 2C from encephalomyocarditis virus bound with ATP
rcsb
molecule keywords Protein 2C
molecule tags Hydrolase
source organism Encephalomyocarditis virus
total genus 62
structure length 208
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2023-11-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...