8X61C

Cryo-em structure of atp-bound ftse(e163q)x
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
299
structure length
161
Chain Sequence
NEQVRYAFHGALQDLKSKPFATFLTVMVIAISLTLPSVCYMVYKNVNVGRVSAMIGVLMVAAVFLVIGNSVRLSIFARRDSINVQKLIGATDGFILRPFLYGGALLGFSGALLSLILSEILVLRLNGLSFDECLLLLLVCSMIGWVAAWLATVQHLRHFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cryo-EM structure of ATP-bound FtsE(E163Q)X
rcsb
molecule tags Transport protein
source organism Escherichia coli k-12
molecule keywords Cell division ATP-binding protein FtsE
total genus 56
structure length 161
sequence length 299
chains with identical sequence D
ec nomenclature
pdb deposition date 2023-11-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...