8X65A

Crystal structure of x11p(p71t) xylanase from a metagenome derived gene from sugarcane bagasse collection site
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
202
structure length
202
Chain Sequence
AQQCITSSQTGNHGGYFYSFWTDGGGSVSFCLQNGGRYTSQWSNVGNWVGGKGWQTGGRRVVSYSGTFNTSGNSYLALYGWTTNPLVEYYIVDSWGTWRPPGGEGYMGTVFSDGGWYDVYRTQRVNAPSIEGIRTFYQYWSVRQQKRVGGTITTGNHFDAWASYGMNLGTHNYMVMATEGFQSSGSSDITVSDGGSSSLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Hyperthermophilic xylanase and thermophilicity analysis by molecular dynamic simulation with quantum mechanics.
pubmed doi rcsb
molecule keywords Endo-1,4-beta-xylanase
molecule tags Hydrolase
source organism Uncultured bacterium
total genus 60
structure length 202
sequence length 202
ec nomenclature ec 3.2.1.8: endo-1,4-beta-xylanase.
pdb deposition date 2023-11-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...