8X66A

Crystal structure of triple mutant x11p(p71t+n13f+q34l) xylanase from a metagenome derived gene from sugarcane bagasse collection site
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
192
structure length
192
Chain Sequence
QQCITSSQTGFHGGYFYSFWTDGGGSVSFCLLNGGRYTSQWSNVGNWVGGKGWQTGGRRVVSYSGTFNTSGNSYLALYGWTTNPLVEYYIVDSWGTWRPPGGEGYMGTVFSDGGWYDVYRTQRVNAPSIEGIRTFYQYWSVRQQKRVGGTITTGNHFDAWASYGMNLGTHNYMVMATEGFQSSGSSDITVSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Engineered hyperthermophilic xylanase from bagasse metagenome and its basis of thermophilicity by molecular dynamic simulation
rcsb
molecule keywords Endo-1,4-beta-xylanase
molecule tags Hydrolase
source organism Uncultured bacterium
total genus 59
structure length 192
sequence length 192
chains with identical sequence B, C
ec nomenclature ec 3.2.1.8: endo-1,4-beta-xylanase.
pdb deposition date 2023-11-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...