8XA8E

Cryo-em structure of bacillus rnap and held complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
MIYKVFYQEKADEVPVREKTDSLYIEGVSERDIRTKLKEKKFNIEFITPVDGAFLEYEQQSENFKVLEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A phage encoded sigA-dependent transcription inhibitor also attacks host HelD-mediated defence system
rcsb
molecule keywords DNA-directed RNA polymerase subunit alpha
molecule tags Transcription
source organism Bacillus
total genus 11
structure length 69
sequence length 69
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2023-12-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...