8XCGI

Tail tip complex of bacteriophage lambda in the open state
Total Genus 0
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
0
sequence length
56
structure length
56
Chain Sequence
TDNGKQNTYFSSLDNMVAQGNVLPVLYGEMRVGSRVVSQEISTADEGDGGQVVVIG

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cryo-EM structure of lambda tail with LamB
rcsb
molecule keywords Tail tip protein M
molecule tags Virus
source organism Escherichia phage lambda
structure length 56
sequence length 56
chains with identical sequence P, h
ec nomenclature
pdb deposition date 2023-12-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...