8XJHA

Crystal structure of arabidopsis n-amino acetyltransferase 2 (atnata2) bound to di-coa
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
203
structure length
198
Chain Sequence
MFSRIRLATPSDVPFIHKLIHQMAVFERLTHLFSATESGLASTLFTSRPFQSFTVFLLEVSRSPFPAPSPDFTPFFKTHNLDLPIDDPESYNFSPDMLNDVVVAGFVLFFPNYSSFLSKPGFYIEDIFVREPYRRKGFGSMLLTAVAKQAVKMGYGRVEWVVLDWNVNAIKFYEQMGAQILQEWRVCRLTGDALEAFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of Arabidopsis N-amino acetyltransferase 2 (AtNATA2) bound to di-CoA
rcsb
molecule keywords GCN5-related N-acetyltransferase 8
molecule tags Transferase
source organism Arabidopsis thaliana
total genus 49
structure length 198
sequence length 203
chains with identical sequence B
ec nomenclature ec 2.3.1.48: histone acetyltransferase.
pdb deposition date 2023-12-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...