8XN4A

Cryo-em structure of the clpp degradation system in streptomyces hawaiiensis
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
182
structure length
182
Chain Sequence
GLGDQVYNRLLNERIIFLGQPVDDDIANKITAQLLLLASDPEKDIYLYINSPGGSITAGMAIYDTMQYIKNDVVTIAMGLAAAMGQFLLSAGTPGKRFALPNAEILIHQPSAGLAGSASDIKIHAERLLHTKKRMAELTSQHTGQTIEQITRDSDRDRWFDAFEAKEYGLIDDVMTTAAGMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into the Clp protein degradation machinery.
pubmed doi rcsb
molecule keywords ATP-dependent Clp protease proteolytic subunit
molecule tags Hydrolase
source organism Streptomyces hawaiiensis
total genus 54
structure length 182
sequence length 182
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.4.21.92: endopeptidase Clp.
pdb deposition date 2023-12-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...