8XVFA

Globular domain of trichinella spiralis calreticulin
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
251
structure length
251
Chain Sequence
SEPTIYLKETFDDGDAWKERWVQSKHKDDYGEWQLSHGKLFADENDMGLKTMQDARFYSLSRKFDKVVDNKDKPLVIVYTVKHEQDIDCGGGYIKLMLENTDLEDFNSDTPYRIMFGPDICGPEKRAVHSILWHDGKNYEKRKNAIAMADIFTHAYKLIIFPNNSYEIWVNNDKEAYGRLEDDWTMTEPGSGPVPELYRYKGLGAIGFELWQVKSGTIFDNILITDDPEYAKEFIDKQLEALRPIEKVESD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title structure of globular domain of Trichinella spiralis calreticulin at 2.76 Angstroms resolution.
rcsb
molecule keywords Calreticulin
molecule tags Chaperone
source organism Trichinella spiralis
total genus 67
structure length 251
sequence length 251
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2024-01-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...