8XY7C

Hphk alpha-gamma subcomplex in active state
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
54
structure length
48
Chain Sequence
TREIVIRDPYALRPLRRLIDAYAFRIYGHWVNRAALFENTPKAVLLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Architecture and activation of human muscle phosphorylase kinase
doi rcsb
molecule keywords Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform
molecule tags Cytosolic protein
source organism Homo sapiens
total genus 11
structure length 48
sequence length 54
ec nomenclature
pdb deposition date 2024-01-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...