8XZVA

Architecture of the spinach plastid-encoded rna polymerase
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
225
structure length
225
Chain Sequence
STQTLQWKCVESRTDSKCLHYGRFILSPLMKGQADTIGIAMRRALLGEIEGTCITRAKSEKIPHEYSTILGIQESVHEILMNLKEIVLRSNLYGTCEASICVRGPRGVTAQDIILPPYVEIVDNTQHIASLTEPIDLCIGLQLERNRGYHIKAPNNFQDGSFPIDALFMPVRNVNHSIHSYGNGNEKQEILFLEIWTNGSLTPKEALYEASRNLIDLLIPFLHAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Architecture of the spinach plastid-encoded RNA polymerase.
pubmed doi rcsb
molecule keywords DNA-directed RNA polymerase subunit alpha
molecule tags Transcription
total genus 38
structure length 225
sequence length 225
chains with identical sequence O
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2024-01-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...