8Y0Q4

Complex of fmdv o/18074 and inter-serotype broadly neutralizing antibodies poa-2
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
71
structure length
46
Chain Sequence
SGNTGSIINNYYMQQYQNSMDTQLGNDWFSKLANTAFSGLFGALLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery, recognized antigenic structures, and evolution of cross-serotype broadly neutralizing antibodies from porcine B-cell repertoires against foot-and-mouth disease virus.
pubmed doi rcsb
molecule keywords VP1 of capsid protein
molecule tags Virus/immune system
source organism Sus scrofa
total genus 5
structure length 46
sequence length 71
ec nomenclature ec 3.6.1.15: nucleoside-triphosphate phosphatase.
pdb deposition date 2024-01-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...