8Y9QA

B-glucosidase from thermotoga profunda tp-bgl
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
448
structure length
448
Chain Sequence
MFPQDFLFGVAMSGFQFEMGKENSKDENTDWYIWTHDLQNQANGVVSRDLVEEGADYWNSYARVHELCSRIGMNVIRIGIEWSRIFPNPTHGIKDPSQIADMKVVEHYKQIIEDAKSRGLKVIVNLNHFTLPLWLHDPIRVSRFNDFSRSGWLDDRSVHEFTKFATFCAKSFDDVDAFTTMNEPNVVAKLGYFGRLSGFPPSLLNIDLYEKALDNQILAHNKAYETMKQFTNKPVGIIYATSWCEGDDARNDAMELENWYFLDRVIDRIDFLGVNYYTRAIVKRTPSVLSSSSGRIKINWSFVPGFGGSCQRNSKSLDGRPSTDNGWEIYPEGLGYVLRSCRDRYKKPLYVTENGVADDRDIYRPYSLLAHLKIVEDCLKENMDLRGYMHWSIIDNFEWPMGYSMRFGLVRVDFKQKLFTPRPSYYLFGQIINSRTTEPFLNLLKAWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights and functional characterization of a novel beta-glucosidase derived from Thermotoga profunda.
pubmed doi rcsb
molecule keywords b-glucosidase
molecule tags Hydrolase
source organism Thermotoga profunda
total genus 183
structure length 448
sequence length 448
chains with identical sequence B
ec nomenclature ec 3.2.1.23: beta-galactosidase.
pdb deposition date 2024-02-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...