8YRFA

Crystal structure of lmrr with v15 replaced by unnatural amino acid 4-amino-l-phenyl-cysteine
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
109
structure length
108
Chain Sequence
PKEMLRAQTNILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFDRLEQDGIISSYWGDESQGGRRKYYRLTEIGHENMRLAFESWSRVDKIIENLEANKKSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of LmrR with V15 replaced by unnatural amino acid 4-amino-L-phenyl-cysteine
rcsb
molecule tags Dna binding protein
source organism Lactococcus cremoris subsp. cremoris mg1363
molecule keywords Transcriptional regulator, PadR-like family
total genus 35
structure length 108
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2024-03-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...